Instagram viewer and editor

#carpets

Instagram Photos and Videos
Hoje vamos falar sobre as nossas queridinhas. As cerâmicas saramenhas são caracterizadas por manchas feitas de óxidos ferrosos e pelo brilho gerado pelo chumbo. Elas são típicas de Minas Gerais e combinam com todas as decorações, sozinhas ou em conjunto. Veja, na foto, como elas são um charme!
Advertisement
‘Scuba Panda’ by @jessiebreakwellgallery The brightest, most vibrant print on canvas with a plethora of animals and patterns. Looks great in a bedroom, dining room, playroom or entry. Size 170 x 80 $1650 @flockofseagullsrye 2211 Point Nepean Rd, Rye. We are open 7 days.
Advertisement
1930’s Antique Persian Serapi Sarouk 2’2”x11’x9” Direct Message For Pricing #woven #wovenrugs
Advertisement
Новая коллекция текстильных шедевров ручной роботы) Ето просто нереально красиво.#Киев #харьков #стиль #ковры #коврыкиев #дизайнеры #архитекторы #интерьер #куплюковер #carpets #rag #Repost
for more, Follow @cute___.pets & tag your bestfriend to discover that ! Watch this to calm down😭❤ From @mie.sueyoshi by @humansfurryfriends #pets #petstagram #petsofinstagram #petsagram #instapets #Shopetsy #picpets #petscorner #petsofig #petshop #cutepets #petsmart #petsgram #worldofcutepets #poshpamperedpets #exoticpets #carpets #petsitting #lovepets #igpets #puppets #petsitter #rescuepetsofinstagram #muppets #friendlypets #inspiredbypets #mypets #whippetsofinstagram #petsoriginal #petsofinsta
Antique #carpets are collectible items. They are sought after by #collectors, dealers #interiordesigners and #privateclients. They are magnificent works of art and as the years go by they are becoming rarer. Come and discover the fascinating world of #caucasian #persian #antique carpets at #nalbandiancarpets. We guarantee that we have the biggest collection in the world! #since1792 #caucasiancarpets #interior #contemporary #modern #antique #achrafieh #lebanon #sofil #nalbandiancarpets
I thought I'd share some rat #cage #InteriorDecorating #tips… I hope you can zoom in enough. This is a #LibertaExplorer, but most of them can be used for the #CritterNation and #SavicRoyalSuite as well; it's mostly the bar orientation that's a bit different, and the exact shape and size of the semi-shelves. . Note that the LE and SRS always (as far as I'm aware) consist of two units; the CN can be purchased as a one or two unit. Obviously, the LE and SRS can also be converted to single units. I always place the shelves on the left, because I'm right-handed. I tried it in reverse once... for one day. Also, the stairs are uncovered in two pics--I don’t do that anymore; I worry that their little legs might get caught and the sleeves are really easy to make. . Rats love #hammocks and they come in several shapes and sizes; you can even make your own. I always try to give them more than one. They also NEED a #Sputnik (seriously, they do--I don't know why, but they absolutely love them... though I suppose if my bed were to look like a spaceshuttle, I might spend more time in it, too, LOL). A #CardboardBox always makes a great house, too. As you can see, I use newspaper / phonebooks / tissues for #NestingMaterial. I also provide #toys, though it really differs who uses what, if at all. All the wood in these pics is rat-safe (willow, if I’m not mistaken). Not everyone uses the #WodentWheel, either, but I always leave it in; sometimes they just like to sleep in it. . I always provide a corner #toilet (#litterbox) as well, though they don’t always use it. It does take up quite a bit of space. But I’ve seen elder/ill rats actively search for it, so they do seem to “get” what it’s for. I usually place the #FoodBowl on the lowest level (less mess if they tip it over?) and try to add a #WaterBowl… provided I don’t have rats who like to stuff it with bedding! The #WaterBottles (ALWAYS more than one, in case it malfunctions!) are on the doors, which are open in these pics, so you can’t see them. . continued in comments . #rat #rats
I’m a #happy #customer ! Get your#carpets #cleaned once a year to remove #grime #spillages make your #environment clean and #healthy #businessmanagementlifecycle #alwayssparklingcleaningservices
Modern_carpets# Kilim... Size:150x100cm Size;6x4feet Export and Delivery wherever you are More information WhatsApp.imo.telegram +989123367123 #فرش#زیباترین#پشم#نخ#زیبا#ایرانی# #دیزاین_داخلی#فرش_دستبافت#قشنگ#بهترینها #دکوراسیون_مدرن#المنزلی#الدیکور# سجادة#جميلة# #rug#Decoration# #Beautiful#_decore#modern# #decortaions#world#carpets#地#‌ #Permaidani#गलीचा#wall#hanging #carpet
Ivan da Silva Bruhns Art Deco (France) Signed with woven stylized IDSB c. 1930-35 . Wool pile with cotton foundation . Woven at Manufacture de Savigny, the carpet seen here demonstrates the direction that Da Silva pushed his Cubist design ideas after he moved away from ‘pure’ Cubism.  While the overall design is still remarkably clean and stark—comprised mainly of broad, overlapping rectilinear forms, Da Silva has included the simple comb motif edge to the central black form, the three wavy lines in the upper left and the pencil thin lines and circles to the bottom field to break up the extreme geometry, enhancing the overall visual interest of the piece.  The synthesis of differing influences is representational of Da Silva’s approach to design in creating objects that are uniquely his own. . . . . . #carpets #rugs #beauvaiscarpets #beauvais #artdeco #deco #cubism #decor #interiors #interordesign #interiorinspo #wool #handwoven #handknotted #dasilvabruhns #arthistory #wovenhistory
Way to go @andersontuftex 👏🏻👏🏻👏🏻 #woodflooring #carpets #studioV
#hazalfilizkucukkose #hazalfilizküçükköse #turkey #traditional #colorful #rugs #carpets #colorfulcarpet #colorfulrug #beautiful #girl #dandy #shoes #jackets #beautifulgirl #ask #seviyorum #sevda #sevgilim
Love this sight💖 Need a carpet?😉❤ ideas #dubai #moroccan #morocco #traditional #colorful #colors #style #decorations #carpets #sight
Look at this beauty #carpets #marrakesh #handknoted #handmade #travel #traveling #socialenvy #PleaseForgiveMe #vacation #visiting #instatravel #instago #instagood #trip #holiday #photooftheday #fun #travelling #tourism #tourist #instapassport #instatraveling #mytravelgram #travelgram #travelingram #igtravel
Beautiful high quality Persian Carpet, Machine woven with 3D effect details #persian #carpets #persiancarpet #Qatar #doha #qatari_and_qataria #interiordesigninspiration #interiordesign #homedecoration #floorwork #roomdecor #interiør #inspiration #royal #designdeinteriores #luxury #artworkoftheday #decoration #interior #interiordesign #decor #roomdecor #interiør #inspiration #interiordesign #homedecor #rugsindoha #rugmiddelest #rugdoha #ruglady #inspiration #lifestyle #qatari_and_qataria_qtr
#TBT to this year’s @AmericasMartATL show when our ‘Karuna’ area rug in colorway Cosmos from the new Om Collection won the Hand-Knotted Category at America’s Magnificent Carpet Awards! 🏆 . . . . . . #Carpet #InteriorDesign #Rugs #InteriorDesigners #HomeDecor #Couristan #Carpets #AreaRugs #CouristanCarpets #InstaDecor #Decor #DecorLovers #InteriorDecorating #HomeDesign #HomeFashion #InteriorDesigner #InteriorDecor #CustomCarpet #HouseTour #ModernHome #DecorLove #Broadloom #InteriorStyling #Interior #InstaDecor #HomeDecoration #DecorGoals #HomeRenovation
Second hand and vintage in our store #secondhand #vintageclothing #hats #silkscarves #jeans #lovevintage #recycle #fashion #skirt #blouses #leatherjacket #trunks #carpets
Dimensions5′6″ × 9′1″ and 0.2″ thick https://www.chairish.com/product/953459 #fashion #style #stylish #love #me #cute  #beauty #beautiful #instagood #pretty #swag #girls #eyes #design #model #styles  #shopping #vintagerug #handmade #turkish #vinartstore #anatolianhall  #carpet #turkishanatolianrug #yorukhali #kayserirug #carpets #rug
Tapetes florais, marcantes e cheios de personalidade! Lindos! #rugs #carpets #design #colors #decoracao #papiliotapetes #tapetespersonalizado #tapetesunicos
#contiki #throwbackthursday #contikidamien #Morocco #fez #carpets